Lineage for d1wbqd2 (1wbq D:177-439)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. Domain d1wbqd2: 1wbq D:177-439 [120859]
    Other proteins in same PDB: d1wbqa1, d1wbqb1, d1wbqc1, d1wbqd1
    automated match to d1n51a2
    complexed with cl, mg, zn

Details for d1wbqd2

PDB Entry: 1wbq (more details), 2.3 Å

PDB Description: znmg substituted aminopeptidase p from e. coli
PDB Compounds: (D:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1wbqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbqd2 d.127.1.1 (D:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

SCOPe Domain Coordinates for d1wbqd2 are not available.

Timeline for d1wbqd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wbqd1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wbqa1, d1wbqa2, d1wbqb1, d1wbqb2, d1wbqc1, d1wbqc2