Lineage for d1wbqb2 (1wbq B:177-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974565Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2974566Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2974594Domain d1wbqb2: 1wbq B:177-439 [120855]
    Other proteins in same PDB: d1wbqa1, d1wbqb1, d1wbqc1, d1wbqd1
    automated match to d1n51a2
    complexed with cl, mg, zn

Details for d1wbqb2

PDB Entry: 1wbq (more details), 2.3 Å

PDB Description: znmg substituted aminopeptidase p from e. coli
PDB Compounds: (B:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1wbqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbqb2 d.127.1.1 (B:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

SCOPe Domain Coordinates for d1wbqb2:

Click to download the PDB-style file with coordinates for d1wbqb2.
(The format of our PDB-style files is described here.)

Timeline for d1wbqb2: