Lineage for d1wbqa1 (1wbq A:1-176)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606533Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 1606534Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)
  6. 1606535Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 1606536Species Escherichia coli [TaxId:562] [53097] (19 PDB entries)
  8. 1606547Domain d1wbqa1: 1wbq A:1-176 [120852]
    Other proteins in same PDB: d1wbqa2, d1wbqb2, d1wbqc2, d1wbqd2
    automated match to d1n51a1
    complexed with cl, mg, zn

Details for d1wbqa1

PDB Entry: 1wbq (more details), 2.3 Å

PDB Description: znmg substituted aminopeptidase p from e. coli
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d1wbqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbqa1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d1wbqa1:

Click to download the PDB-style file with coordinates for d1wbqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wbqa1: