![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
![]() | Protein Tryptophan synthase, beta-subunit [53688] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [53689] (42 PDB entries) |
![]() | Domain d1wbjb1: 1wbj B:2-391 [120849] Other proteins in same PDB: d1wbja1 automatically matched to d1k3ub_ complexed with g3p, na, plp |
PDB Entry: 1wbj (more details), 1.5 Å
SCOP Domain Sequences for d1wbjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbjb1 c.79.1.1 (B:2-391) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 602]} ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm mreqpekeqllvvnlsgrgdkdiftvhdil
Timeline for d1wbjb1: