SCOPe 2.07: Domain d1wbja_: 1wbj A:

Lineage for d1wbja_ (1wbj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries)

8. Domain d1wbja_: 1wbj A: [120848]
   Other proteins in same PDB: d1wbjb_
   automated match to d1k3ua_
   complexed with g3p, na, plp

Details for d1wbja_

PDB Entry: 1wbj, 1.5 Å

PDB Description: wildtype tryptophan synthase complexed with glycerol phosphate

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1wbja_:

Sequence; same for both SEQRES and ATOM records:

>d1wbja_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

Timeline for d1wbja_:

• d1wbja_ first appeared in SCOP 1.73, called d1wbja1
  
• d1wbja_ appears in SCOPe 2.06
  
• d1wbja_ appears in the current release, SCOPe 2.08