| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) ![]() |
| Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) |
| Protein Trp synthase alpha-subunit [51388] (5 species) |
| Species Salmonella typhimurium [TaxId:90371] [51389] (42 PDB entries) |
| Domain d1wbja1: 1wbj A:1-267 [120848] Other proteins in same PDB: d1wbjb1 automatically matched to d1k8xa_ complexed with g3p, na, plp |
PDB Entry: 1wbj (more details), 1.5 Å
SCOP Domain Sequences for d1wbja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbja1 c.1.2.4 (A:1-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 602]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr
Timeline for d1wbja1: