Lineage for d1wbja1 (1wbj A:1-267)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681489Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 681519Protein Trp synthase alpha-subunit [51388] (5 species)
  7. 681543Species Salmonella typhimurium [TaxId:90371] [51389] (42 PDB entries)
  8. 681547Domain d1wbja1: 1wbj A:1-267 [120848]
    Other proteins in same PDB: d1wbjb1
    automatically matched to d1k8xa_
    complexed with g3p, na, plp

Details for d1wbja1

PDB Entry: 1wbj (more details), 1.5 Å

PDB Description: wildtype tryptophan synthase complexed with glycerol phosphate
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOP Domain Sequences for d1wbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbja1 c.1.2.4 (A:1-267) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 602]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

SCOP Domain Coordinates for d1wbja1:

Click to download the PDB-style file with coordinates for d1wbja1.
(The format of our PDB-style files is described here.)

Timeline for d1wbja1: