Lineage for d1wbhc1 (1wbh C:1-213)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684243Protein KDPG aldolase [51584] (3 species)
  7. 684244Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)
  8. 684247Domain d1wbhc1: 1wbh C:1-213 [120847]
    automatically matched to 1WBH A:1-213
    complexed with po4; mutant

Details for d1wbhc1

PDB Entry: 1wbh (more details), 1.55 Å

PDB Description: crystal structure of the e45n mutant from kdpg aldolase from escherichia coli
PDB Compounds: (C:) khg/kdpg aldolase

SCOP Domain Sequences for d1wbhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbhc1 c.1.10.1 (C:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

SCOP Domain Coordinates for d1wbhc1:

Click to download the PDB-style file with coordinates for d1wbhc1.
(The format of our PDB-style files is described here.)

Timeline for d1wbhc1: