Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) automatically mapped to Pfam PF01624 |
Family d.75.2.0: automated matches [254200] (1 protein) not a true family |
Protein automated matches [254440] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254937] (3 PDB entries) |
Domain d1wbda4: 1wbd A:2-116 [120844] Other proteins in same PDB: d1wbda1, d1wbda2, d1wbda3, d1wbdb1, d1wbdb2, d1wbdb3 automated match to d1w7aa4 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbd (more details), 2.4 Å
SCOPe Domain Sequences for d1wbda4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbda4 d.75.2.0 (A:2-116) automated matches {Escherichia coli [TaxId: 562]} saienfdahtpmmqqylrlkaqhpeillfyrmgdfyqlfyddakrasqlldisltkrgas agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1wbda4: