Lineage for d1wbda3 (1wbd A:117-269)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887747Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2887775Family c.55.6.0: automated matches [254201] (1 protein)
    not a true family
  6. 2887776Protein automated matches [254441] (1 species)
    not a true protein
  7. 2887777Species Escherichia coli [TaxId:562] [254938] (3 PDB entries)
  8. 2887778Domain d1wbda3: 1wbd A:117-269 [120843]
    Other proteins in same PDB: d1wbda1, d1wbda2, d1wbda4, d1wbdb2, d1wbdb3
    automated match to d1wb9a3
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbda3

PDB Entry: 1wbd (more details), 2.4 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38q mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbda3 c.55.6.0 (A:117-269) automated matches {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1wbda3:

Click to download the PDB-style file with coordinates for d1wbda3.
(The format of our PDB-style files is described here.)

Timeline for d1wbda3: