Lineage for d1wbda1 (1wbd A:270-566)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646689Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 646690Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 646691Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 646692Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 646693Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
  8. 646701Domain d1wbda1: 1wbd A:270-566 [120841]
    Other proteins in same PDB: d1wbda2, d1wbda3, d1wbda4
    automatically matched to d1e3ma1
    complexed with adp, mg; mutant

Details for d1wbda1

PDB Entry: 1wbd (more details), 2.4 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38q mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1wbda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbda1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1wbda1:

Click to download the PDB-style file with coordinates for d1wbda1.
(The format of our PDB-style files is described here.)

Timeline for d1wbda1: