Lineage for d1wbba3 (1wbb A:117-269)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2140751Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2140779Family c.55.6.0: automated matches [254201] (1 protein)
    not a true family
  6. 2140780Protein automated matches [254441] (1 species)
    not a true protein
  7. 2140781Species Escherichia coli [TaxId:562] [254938] (2 PDB entries)
  8. 2140784Domain d1wbba3: 1wbb A:117-269 [120839]
    Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba4, d1wbbb2, d1wbbb3
    automated match to d1wb9a3
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbba3

PDB Entry: 1wbb (more details), 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbba3 c.55.6.0 (A:117-269) automated matches {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1wbba3:

Click to download the PDB-style file with coordinates for d1wbba3.
(The format of our PDB-style files is described here.)

Timeline for d1wbba3: