Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) |
Family c.55.6.0: automated matches [254201] (1 protein) not a true family |
Protein automated matches [254441] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254938] (2 PDB entries) |
Domain d1wbba3: 1wbb A:117-269 [120839] Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba4, d1wbbb2, d1wbbb3 automated match to d1wb9a3 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbb (more details), 2.5 Å
SCOPe Domain Sequences for d1wbba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbba3 c.55.6.0 (A:117-269) automated matches {Escherichia coli [TaxId: 562]} gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1wbba3: