Lineage for d1wb9a3 (1wb9 A:117-269)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495564Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2495565Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 2495566Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 2495567Species Escherichia coli [TaxId:562] [53154] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2495568Domain d1wb9a3: 1wb9 A:117-269 [120835]
    Other proteins in same PDB: d1wb9a1, d1wb9a2, d1wb9a4
    automatically matched to d1e3ma3
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wb9a3

PDB Entry: 1wb9 (more details), 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wb9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1wb9a3:

Click to download the PDB-style file with coordinates for d1wb9a3.
(The format of our PDB-style files is described here.)

Timeline for d1wb9a3: