Lineage for d1wb6b_ (1wb6 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869452Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1869505Protein automated matches [190097] (2 species)
    not a true protein
  7. 1869508Species Clostridium thermocellum [TaxId:1515] [186819] (3 PDB entries)
  8. 1869512Domain d1wb6b_: 1wb6 B: [120832]
    automated match to d1gkla_
    complexed with act, cd, gol, vxx; mutant

Details for d1wb6b_

PDB Entry: 1wb6 (more details), 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with vanillate
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1wb6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb6b_ c.69.1.2 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d1wb6b_:

Click to download the PDB-style file with coordinates for d1wb6b_.
(The format of our PDB-style files is described here.)

Timeline for d1wb6b_: