SCOP 1.73: Domain d1wb6b1: 1wb6 B:803-1075

Lineage for d1wb6b1 (1wb6 B:803-1075)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (5 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)

8. Domain d1wb6b1: 1wb6 B:803-1075 [120832]
   automatically matched to d1gkla_
   complexed with act, cd, gol, vxx; mutant

Details for d1wb6b1

PDB Entry: 1wb6, 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with vanillate

PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOP Domain Sequences for d1wb6b1:

Sequence; same for both SEQRES and ATOM records:

>d1wb6b1 c.69.1.2 (B:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyff

Timeline for d1wb6b1:

• d1wb6b1 is new in SCOP 1.73
  
• d1wb6b1 appears in SCOP 1.75
  
• d1wb6b1 appears in the current release, SCOPe 2.08, called d1wb6b2