![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
![]() | Protein automated matches [190097] (2 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [186819] (3 PDB entries) |
![]() | Domain d1wb6b2: 1wb6 B:803-1077 [120832] Other proteins in same PDB: d1wb6a3, d1wb6b3 automated match to d1gkla_ complexed with act, cd, gol, vxx; mutant |
PDB Entry: 1wb6 (more details), 1.4 Å
SCOPe Domain Sequences for d1wb6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb6b2 c.69.1.2 (B:803-1077) automated matches {Clostridium thermocellum [TaxId: 1515]} sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd fskgnfyflvapgathwwgyvrhyiydalpyffhe
Timeline for d1wb6b2: