Lineage for d1wb5b_ (1wb5 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1002882Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1002931Protein automated matches [190097] (1 species)
    not a true protein
  7. 1002932Species Clostridium thermocellum [TaxId:1515] [186819] (3 PDB entries)
  8. 1002938Domain d1wb5b_: 1wb5 B: [120830]
    automated match to d1gkla_
    complexed with act, cd, gol, syr; mutant

Details for d1wb5b_

PDB Entry: 1wb5 (more details), 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with syringate
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1wb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb5b_ c.69.1.2 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d1wb5b_:

Click to download the PDB-style file with coordinates for d1wb5b_.
(The format of our PDB-style files is described here.)

Timeline for d1wb5b_: