Lineage for d1wb4b1 (1wb4 B:803-1075)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 706870Family c.69.1.2: Carboxylesterase [53487] (5 proteins)
  6. 706887Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 706888Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 706890Domain d1wb4b1: 1wb4 B:803-1075 [120828]
    automatically matched to d1gkla_
    complexed with acy, cd, gol, sxx; mutant

Details for d1wb4b1

PDB Entry: 1wb4 (more details), 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with sinapinate
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOP Domain Sequences for d1wb4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb4b1 c.69.1.2 (B:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyff

SCOP Domain Coordinates for d1wb4b1:

Click to download the PDB-style file with coordinates for d1wb4b1.
(The format of our PDB-style files is described here.)

Timeline for d1wb4b1: