Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
Protein automated matches [190097] (2 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [186819] (3 PDB entries) |
Domain d1wb4a_: 1wb4 A: [120827] automated match to d1gkla_ complexed with acy, cd, gol, sxx; mutant |
PDB Entry: 1wb4 (more details), 1.4 Å
SCOPe Domain Sequences for d1wb4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb4a_ c.69.1.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]} sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
Timeline for d1wb4a_: