Lineage for d1wb4a_ (1wb4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869452Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1869505Protein automated matches [190097] (2 species)
    not a true protein
  7. 1869508Species Clostridium thermocellum [TaxId:1515] [186819] (3 PDB entries)
  8. 1869509Domain d1wb4a_: 1wb4 A: [120827]
    automated match to d1gkla_
    complexed with acy, cd, gol, sxx; mutant

Details for d1wb4a_

PDB Entry: 1wb4 (more details), 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with sinapinate
PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1wb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb4a_ c.69.1.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d1wb4a_:

Click to download the PDB-style file with coordinates for d1wb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wb4a_: