SCOPe 2.07: Domain d1wb0a1: 1wb0 A:22-266,A:337-388

Lineage for d1wb0a1 (1wb0 A:22-266,A:337-388)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitotriosidase [82251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82252] (11 PDB entries)

8. Domain d1wb0a1: 1wb0 A:22-266,A:337-388 [120825]
   Other proteins in same PDB: d1wb0a2
   automatically matched to d1hkia1
   complexed with gol, ipa, so4

Details for d1wb0a1

PDB Entry: 1wb0, 1.65 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitor argifin against human chitinase

PDB Compounds: (A:) chitotriosidase 1

SCOPe Domain Sequences for d1wb0a1:

Sequence; same for both SEQRES and ATOM records:

>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels

Timeline for d1wb0a1:

• d1wb0a1 first appeared in SCOP 1.73
  
• d1wb0a1 appears in SCOPe 2.06
  
• d1wb0a1 appears in the current release, SCOPe 2.08