Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.5: Type II chitinase [51534] (14 proteins) glycosylase family 18 |
Protein Chitotriosidase [82251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82252] (10 PDB entries) |
Domain d1wb0a1: 1wb0 A:22-266,A:337-388 [120825] Other proteins in same PDB: d1wb0a2 automatically matched to d1hkia1 complexed with gol, ipa, rag, so4 |
PDB Entry: 1wb0 (more details), 1.65 Å
SCOP Domain Sequences for d1wb0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels
Timeline for d1wb0a1: