| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Chitotriosidase [82628] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries) |
| Domain d1wawa2: 1waw A:267-336 [120823] Other proteins in same PDB: d1wawa1 automatically matched to d1hkia2 complexed with gol, ipa, rig, so4 |
PDB Entry: 1waw (more details), 1.75 Å
SCOP Domain Sequences for d1wawa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wawa2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf
Timeline for d1wawa2: