Lineage for d1waua_ (1wau A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834863Protein KDPG aldolase [51584] (3 species)
  7. 2834864Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)
  8. 2834883Domain d1waua_: 1wau A: [120821]
    automated match to d1euaa_
    complexed with so4; mutant

Details for d1waua_

PDB Entry: 1wau (more details), 2.8 Å

PDB Description: structure of kdpg aldolase e45n mutant
PDB Compounds: (A:) khg/kdpg aldolase

SCOPe Domain Sequences for d1waua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1waua_ c.1.10.1 (A:) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

SCOPe Domain Coordinates for d1waua_:

Click to download the PDB-style file with coordinates for d1waua_.
(The format of our PDB-style files is described here.)

Timeline for d1waua_: