SCOPe 2.06: Domain d1wao41: 1wao 4:23-175

Lineage for d1wao41 (1wao 4:23-175)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Protein phosphatase 5 [48454] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)

8. Domain d1wao41: 1wao 4:23-175 [120819]
   Other proteins in same PDB: d1wao12, d1wao22, d1wao32, d1wao42
   automatically matched to d1a17__
   complexed with mn

Details for d1wao41

PDB Entry: 1wao, 2.9 Å

PDB Description: pp5 structure

PDB Compounds: (4:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao41:

Sequence, based on SEQRES records:

>d1wao41 a.118.8.1 (4:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede

Sequence, based on observed residues (ATOM records):

>d1wao41 a.118.8.1 (4:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferakrsvvdsldiesmtiede

Timeline for d1wao41:

• d1wao41 first appeared in SCOP 1.73
  
• d1wao41 appears in SCOPe 2.05
  
• d1wao41 appears in SCOPe 2.07
  
• d1wao41 appears in the current release, SCOPe 2.08