Lineage for d1wao41 (1wao 4:23-175)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333882Protein Protein phosphatase 5 [48454] (1 species)
  7. 2333883Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)
  8. 2333888Domain d1wao41: 1wao 4:23-175 [120819]
    Other proteins in same PDB: d1wao12, d1wao22, d1wao32, d1wao42
    automatically matched to d1a17__
    complexed with mn

Details for d1wao41

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (4:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao41:

Sequence, based on SEQRES records: (download)

>d1wao41 a.118.8.1 (4:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede

Sequence, based on observed residues (ATOM records): (download)

>d1wao41 a.118.8.1 (4:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferakrsvvdsldiesmtiede

SCOPe Domain Coordinates for d1wao41:

Click to download the PDB-style file with coordinates for d1wao41.
(The format of our PDB-style files is described here.)

Timeline for d1wao41: