Lineage for d1wao31 (1wao 3:23-175)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007433Protein Protein phosphatase 5 [48454] (1 species)
  7. 2007434Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)
  8. 2007438Domain d1wao31: 1wao 3:23-175 [120817]
    Other proteins in same PDB: d1wao12, d1wao22, d1wao32, d1wao42
    automatically matched to d1a17__
    complexed with mn

Details for d1wao31

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (3:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao31:

Sequence, based on SEQRES records: (download)

>d1wao31 a.118.8.1 (3:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede

Sequence, based on observed residues (ATOM records): (download)

>d1wao31 a.118.8.1 (3:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferakrsvvdsldiesmtiede

SCOPe Domain Coordinates for d1wao31:

Click to download the PDB-style file with coordinates for d1wao31.
(The format of our PDB-style files is described here.)

Timeline for d1wao31: