SCOPe 2.08: Domain d1wao22: 1wao 2:176-497

Lineage for d1wao22 (1wao 2:176-497)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries)
   Uniprot P53041 176-499

8. Domain d1wao22: 1wao 2:176-497 [120816]
   Other proteins in same PDB: d1wao11, d1wao21, d1wao31, d1wao41
   automatically matched to d1s95b_
   complexed with mn

Details for d1wao22

PDB Entry: 1wao, 2.9 Å

PDB Description: pp5 structure

PDB Compounds: (2:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao22:

Sequence; same for both SEQRES and ATOM records:

>d1wao22 d.159.1.3 (2:176-497) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantllqlg

Timeline for d1wao22:

• d1wao22 first appeared in SCOP 1.73
  
• d1wao22 appears in SCOPe 2.07