Lineage for d1wao12 (1wao 1:176-499)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736785Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 736786Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 736829Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)
  6. 736864Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 736865Species Human (Homo sapiens) [TaxId:9606] [111232] (2 PDB entries)
  8. 736868Domain d1wao12: 1wao 1:176-499 [120814]
    Other proteins in same PDB: d1wao11, d1wao21, d1wao31, d1wao41
    automatically matched to d1s95b_
    complexed with mn

Details for d1wao12

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (1:) serine/threonine protein phosphatase 5

SCOP Domain Sequences for d1wao12:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wao12 d.159.1.3 (1:176-499) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantllqlgmm

SCOP Domain Coordinates for d1wao12:

Click to download the PDB-style file with coordinates for d1wao12.
(The format of our PDB-style files is described here.)

Timeline for d1wao12: