Lineage for d1wao11 (1wao 1:23-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726770Protein Protein phosphatase 5 [48454] (1 species)
  7. 2726771Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)
  8. 2726773Domain d1wao11: 1wao 1:23-175 [120813]
    Other proteins in same PDB: d1wao12, d1wao22, d1wao32, d1wao42
    automatically matched to d1a17__
    complexed with mn

Details for d1wao11

PDB Entry: 1wao (more details), 2.9 Å

PDB Description: pp5 structure
PDB Compounds: (1:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1wao11:

Sequence, based on SEQRES records: (download)

>d1wao11 a.118.8.1 (1:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede

Sequence, based on observed residues (ATOM records): (download)

>d1wao11 a.118.8.1 (1:23-175) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferakrsvvdsldiesmtiede

SCOPe Domain Coordinates for d1wao11:

Click to download the PDB-style file with coordinates for d1wao11.
(The format of our PDB-style files is described here.)

Timeline for d1wao11: