SCOPe 2.05: Domain d1wama2: 1wam A:248-316

Lineage for d1wama2 (1wam A:248-316)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.7: UDP-galactopyranose mutase [69670] (1 protein)

6. Protein UDP-galactopyranose mutase [69671] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [117845] (3 PDB entries)
   Uniprot Q48485

8. Domain d1wama2: 1wam A:248-316 [120812]
   Other proteins in same PDB: d1wama1
   automatically matched to d1usja2
   complexed with fad

Details for d1wama2

PDB Entry: 1wam, 2.35 Å

PDB Description: structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh-

PDB Compounds: (A:) udp-galactopyranose mutase

SCOPe Domain Sequences for d1wama2:

Sequence; same for both SEQRES and ATOM records:

>d1wama2 d.16.1.7 (A:248-316) UDP-galactopyranose mutase {Klebsiella pneumoniae [TaxId: 573]}
gyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcykeysrace
endipyypi

Timeline for d1wama2:

• d1wama2 first appeared in SCOP 1.73
  
• d1wama2 appears in SCOPe 2.04
  
• d1wama2 appears in SCOPe 2.06
  
• d1wama2 appears in the current release, SCOPe 2.08