![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.7: UDP-galactopyranose mutase [69670] (1 protein) |
![]() | Protein UDP-galactopyranose mutase [69671] (2 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [117845] (3 PDB entries) Uniprot Q48485 |
![]() | Domain d1wama2: 1wam A:248-316 [120812] Other proteins in same PDB: d1wama1 automatically matched to d1usja2 complexed with fad |
PDB Entry: 1wam (more details), 2.35 Å
SCOPe Domain Sequences for d1wama2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wama2 d.16.1.7 (A:248-316) UDP-galactopyranose mutase {Klebsiella pneumoniae [TaxId: 573]} gyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcykeysrace endipyypi
Timeline for d1wama2: