Lineage for d1wama1 (1wam A:3-243,A:317-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097360Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2097361Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2097455Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein)
    domain structure is similar to that of D-aminoacid oxidase
  6. 2097456Protein UDP-galactopyranose mutase, N-terminal domain [69428] (2 species)
  7. 2097460Species Klebsiella pneumoniae [TaxId:573] [117446] (3 PDB entries)
    Uniprot Q48485
  8. 2097463Domain d1wama1: 1wam A:3-243,A:317-383 [120811]
    Other proteins in same PDB: d1wama2
    automatically matched to d1usja1
    complexed with fad

Details for d1wama1

PDB Entry: 1wam (more details), 2.35 Å

PDB Description: structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh-
PDB Compounds: (A:) udp-galactopyranose mutase

SCOPe Domain Sequences for d1wama1:

Sequence, based on SEQRES records: (download)

>d1wama1 c.4.1.3 (A:3-243,A:317-383) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}
skkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphif
htdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearalia
ekgdstiadpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfnyd
dnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafygy
qXrqmgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaevylnsltenq
pmpvftvsv

Sequence, based on observed residues (ATOM records): (download)

>d1wama1 c.4.1.3 (A:3-243,A:317-383) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}
skkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphif
htdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearalia
ekgddpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfnyddnyf
nhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafygyqXrq
mgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaevylnsltenqpmpv
ftvsv

SCOPe Domain Coordinates for d1wama1:

Click to download the PDB-style file with coordinates for d1wama1.
(The format of our PDB-style files is described here.)

Timeline for d1wama1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wama2