![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
![]() | Family a.25.3.1: ESAT-6 like [140454] (3 proteins) Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip |
![]() | Protein ESAT-6, EsxA [140457] (1 species) 6 kDa early secretory antigenic target |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries) Uniprot P0A564 1-94 |
![]() | Domain d1wa8b1: 1wa8 B:602-695 [120810] Other proteins in same PDB: d1wa8a1 |
PDB Entry: 1wa8 (more details)
SCOPe Domain Sequences for d1wa8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa8b1 a.25.3.1 (B:602-695) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]} teqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdat atelnnalqnlartiseagqamastegnvtgmfa
Timeline for d1wa8b1: