Lineage for d1wa8b1 (1wa8 B:602-695)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 912364Superfamily a.25.3: EsxAB dimer-like [140453] (1 family) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 912365Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
    Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
  6. 912369Protein ESAT-6, EsxA [140457] (1 species)
    6 kDa early secretory antigenic target
  7. 912370Species Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries)
    Uniprot P0A564 1-94
  8. 912373Domain d1wa8b1: 1wa8 B:602-695 [120810]
    Other proteins in same PDB: d1wa8a1

Details for d1wa8b1

PDB Entry: 1wa8 (more details)

PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria
PDB Compounds: (B:) 6 kda early secretory antigenic target (esat-6)

SCOPe Domain Sequences for d1wa8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wa8b1 a.25.3.1 (B:602-695) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]}
teqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdat
atelnnalqnlartiseagqamastegnvtgmfa

SCOPe Domain Coordinates for d1wa8b1:

Click to download the PDB-style file with coordinates for d1wa8b1.
(The format of our PDB-style files is described here.)

Timeline for d1wa8b1: