SCOP 1.73: Domain d1wa8b1: 1wa8 B:602-695

Lineage for d1wa8b1 (1wa8 B:602-695)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (1 family)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.1: ESAT-6 like [140454] (2 proteins)
   Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip

6. Protein ESAT-6, EsxA [140457] (1 species)
   6 kDa early secretory antigenic target

7. Species Mycobacterium tuberculosis [TaxId:1773] [140458] (1 PDB entry)

8. Domain d1wa8b1: 1wa8 B:602-695 [120810]
   Other proteins in same PDB: d1wa8a1

Details for d1wa8b1

PDB Entry: 1wa8

PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria

PDB Compounds: (B:) 6 kda early secretory antigenic target (esat-6)

SCOP Domain Sequences for d1wa8b1:

Sequence; same for both SEQRES and ATOM records:

>d1wa8b1 a.25.3.1 (B:602-695) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]}
teqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdat
atelnnalqnlartiseagqamastegnvtgmfa

Timeline for d1wa8b1:

• d1wa8b1 is new in SCOP 1.73
  
• d1wa8b1 appears in SCOP 1.75
  
• d1wa8b1 appears in the current release, SCOPe 2.08