SCOPe 2.07: Domain d1wa8a1: 1wa8 A:1-99

Lineage for d1wa8a1 (1wa8 A:1-99)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
   Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip

6. Protein ESAT-6 like protein EsxB [140455] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140456] (1 PDB entry)
   Uniprot P0A566 1-99

8. Domain d1wa8a1: 1wa8 A:1-99 [120809]
   Other proteins in same PDB: d1wa8b1

Details for d1wa8a1

PDB Entry: 1wa8

PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria

PDB Compounds: (A:) esat-6 like protein esxb

SCOPe Domain Sequences for d1wa8a1:

Sequence; same for both SEQRES and ATOM records:

>d1wa8a1 a.25.3.1 (A:1-99) ESAT-6 like protein EsxB {Mycobacterium tuberculosis [TaxId: 1773]}
aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea
ankqkqeldeistnirqagvqysradeeqqqalssqmgf

Timeline for d1wa8a1:

• d1wa8a1 first appeared in SCOP 1.73
  
• d1wa8a1 appears in SCOPe 2.06
  
• d1wa8a1 appears in the current release, SCOPe 2.08