SCOPe 2.02: Domain d1wa3b_: 1wa3 B:

Lineage for d1wa3b_ (1wa3 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries)

8. Domain d1wa3b_: 1wa3 B: [120803]
   automated match to d1vlwb_
   complexed with pyr, so4

Details for d1wa3b_

PDB Entry: 1wa3, 1.9 Å

PDB Description: Mechanism of the Class I KDPG aldolase

PDB Compounds: (B:) 2-keto-3-deoxy-6-phosphogluconate aldolase

SCOPe Domain Sequences for d1wa3b_:

Sequence; same for both SEQRES and ATOM records:

>d1wa3b_ c.1.10.1 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek
gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam
klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal
vkgtpdevrekakafvekirgc

Timeline for d1wa3b_:

• d1wa3b_ first appeared in SCOP 1.73, called d1wa3b1
  
• d1wa3b_ appears in SCOPe 2.01
  
• d1wa3b_ appears in SCOPe 2.03
  
• d1wa3b_ appears in the current release, SCOPe 2.08