Lineage for d1w9ya1 (1w9y A:2-308)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070787Family b.82.2.1: Penicillin synthase-like [51198] (5 protein domains)
    common fold is rather distorted
  6. 2070788Protein 1-aminocyclopropane-1-carboxylate oxidase 1 [141621] (1 species)
  7. 2070789Species Petunia hybrida [TaxId:4102] [141622] (3 PDB entries)
    Uniprot Q08506 2-308
  8. 2070790Domain d1w9ya1: 1w9y A:2-308 [120801]
    complexed with so4

Details for d1w9ya1

PDB Entry: 1w9y (more details), 2.1 Å

PDB Description: the structure of acc oxidase
PDB Compounds: (A:) 1-aminocyclopropane-1-carboxylate oxidase 1

SCOPe Domain Sequences for d1w9ya1:

Sequence, based on SEQRES records: (download)

>d1w9ya1 b.82.2.1 (A:2-308) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakeprf
eamkame

Sequence, based on observed residues (ATOM records): (download)

>d1w9ya1 b.82.2.1 (A:2-308) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkame

SCOPe Domain Coordinates for d1w9ya1:

Click to download the PDB-style file with coordinates for d1w9ya1.
(The format of our PDB-style files is described here.)

Timeline for d1w9ya1: