Lineage for d1w9xa2 (1w9x A:5-398)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (10 species) - Species Bacillus halmapalus [TaxId:79882] [141768] (1 PDB entry)
Uniprot P19571 38-431 
Domain d1w9xa2: 1w9x A:5-398 [120800]
Other proteins in same PDB: d1w9xa1
complexed with ca, na
Details for d1w9xa2
PDB Entry: 1w9x (more details), 2.1 Å
PDB Description: bacillus halmapalus alpha amylase
PDB Compounds: (A:) alpha amylaseSCOPe Domain Sequences for d1w9xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9xa2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus halmapalus [TaxId: 79882]}
tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
svfygdyygipthsvpamkakidpilearqnfay
SCOPe Domain Coordinates for d1w9xa2:
Click to download the PDB-style file with coordinates for d1w9xa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w9xa2:
- d1w9xa2 first appeared in SCOP 1.73
- d1w9xa2 appears in SCOPe 2.07
View in 3D
