Lineage for d1w9xa1 (1w9x A:399-485)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2066965Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2067070Protein Bacterial alpha-Amylase [51013] (9 species)
  7. Species Bacillus halmapalus [TaxId:79882] [141551] (1 PDB entry)
    Uniprot P19571 432-518
  8. 2067072Domain d1w9xa1: 1w9x A:399-485 [120799]
    Other proteins in same PDB: d1w9xa2
    complexed with ca, na

Details for d1w9xa1

PDB Entry: 1w9x (more details), 2.1 Å

PDB Description: bacillus halmapalus alpha amylase
PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1w9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9xa1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]}
gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk
pgtvtinadgwanfsvnggsvsiwvkr

SCOPe Domain Coordinates for d1w9xa1:

Click to download the PDB-style file with coordinates for d1w9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1w9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9xa2