SCOPe 2.08: Domain d1w9xa1: 1w9x A:399-485

Lineage for d1w9xa1 (1w9x A:399-485)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus halmapalus [TaxId:79882] [141551] (1 PDB entry)
   Uniprot P19571 432-518

8. Domain d1w9xa1: 1w9x A:399-485 [120799]
   Other proteins in same PDB: d1w9xa2
   complexed with ca, na

Details for d1w9xa1

PDB Entry: 1w9x, 2.1 Å

PDB Description: bacillus halmapalus alpha amylase

PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1w9xa1:

Sequence; same for both SEQRES and ATOM records:

>d1w9xa1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]}
gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk
pgtvtinadgwanfsvnggsvsiwvkr

Timeline for d1w9xa1:

• d1w9xa1 first appeared in SCOP 1.73
  
• d1w9xa1 appears in SCOPe 2.07