SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1w9xa1 (1w9x A:399-485)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2066965Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2067070Protein Bacterial alpha-Amylase [51013] (9 species)
  7. Species Bacillus halmapalus [TaxId:79882] [141551] (1 PDB entry)
    Uniprot P19571 432-518
  8. 2067072Domain d1w9xa1: 1w9x A:399-485 [120799]
    Other proteins in same PDB: d1w9xa2
    complexed with ca, na

Details for d1w9xa1

PDB Entry: 1w9x (more details), 2.1 Å

PDB Description: bacillus halmapalus alpha amylase
PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1w9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9xa1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus halmapalus [TaxId: 79882]}
gtqhdyfdhhniigwtregntthpnsglatimsdgpggekwmyvgqnkagqvwhditgnk
pgtvtinadgwanfsvnggsvsiwvkr

SCOPe Domain Coordinates for d1w9xa1:

Click to download the PDB-style file with coordinates for d1w9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1w9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9xa2