Lineage for d1w9vb2 (1w9v B:299-360)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1200057Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1200058Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1200059Protein Chitinase 1 [54562] (2 species)
  7. 1200060Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries)
    Uniprot Q873X9
  8. 1200084Domain d1w9vb2: 1w9v B:299-360 [120798]
    Other proteins in same PDB: d1w9va1, d1w9vb1
    automatically matched to 1W9V A:299-360
    complexed with so4

Details for d1w9vb2

PDB Entry: 1w9v (more details), 2 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide argifin against aspergillus fumigatus
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d1w9vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9vb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

SCOPe Domain Coordinates for d1w9vb2:

Click to download the PDB-style file with coordinates for d1w9vb2.
(The format of our PDB-style files is described here.)

Timeline for d1w9vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9vb1