Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase 1 [54562] (2 species) |
Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries) Uniprot Q873X9 |
Domain d1w9vb2: 1w9v B:299-360 [120798] Other proteins in same PDB: d1w9va1, d1w9vb1 automatically matched to 1W9V A:299-360 complexed with so4 |
PDB Entry: 1w9v (more details), 2 Å
SCOPe Domain Sequences for d1w9vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9vb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli sy
Timeline for d1w9vb2: