![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (14 proteins) glycosylase family 18 |
![]() | Protein Chitinase 1 [51548] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117368] (9 PDB entries) |
![]() | Domain d1w9vb1: 1w9v B:39-298,B:361-433 [120797] Other proteins in same PDB: d1w9va2, d1w9vb2 automatically matched to 1W9V A:39-298,A:361-433 complexed with rag, so4 |
PDB Entry: 1w9v (more details), 2 Å
SCOP Domain Sequences for d1w9vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9vb1 c.1.8.5 (B:39-298,B:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt vvnalggtgvfeqsqneldypvsqydnlrngmqt
Timeline for d1w9vb1: