![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase 1 [54562] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries) Uniprot Q873X9 |
![]() | Domain d1w9va2: 1w9v A:299-360 [120796] Other proteins in same PDB: d1w9va1, d1w9vb1 complexed with rag, so4 |
PDB Entry: 1w9v (more details), 2 Å
SCOP Domain Sequences for d1w9va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9va2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli sy
Timeline for d1w9va2: