Lineage for d1w9va1 (1w9v A:39-298,A:361-433)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683248Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 683249Protein Chitinase 1 [51548] (2 species)
  7. 683250Species Aspergillus fumigatus [TaxId:5085] [117368] (9 PDB entries)
  8. 683265Domain d1w9va1: 1w9v A:39-298,A:361-433 [120795]
    Other proteins in same PDB: d1w9va2, d1w9vb2
    complexed with rag, so4

Details for d1w9va1

PDB Entry: 1w9v (more details), 2 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide argifin against aspergillus fumigatus
PDB Compounds: (A:) chitinase

SCOP Domain Sequences for d1w9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9va1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

SCOP Domain Coordinates for d1w9va1:

Click to download the PDB-style file with coordinates for d1w9va1.
(The format of our PDB-style files is described here.)

Timeline for d1w9va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9va2