SCOP 1.73: Domain d1w9ob2: 1w9o B:197-272

Lineage for d1w9ob2 (1w9o B:197-272)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1w9ob2: 1w9o B:197-272 [120790]
   automatically matched to d1ntea_
   complexed with bez

Details for d1w9ob2

PDB Entry: 1w9o, 2.25 Å

PDB Description: crystal structure of the pdz tandem of human syntenin in complex with tneyyv peptide

PDB Compounds: (B:) Syntenin 1

SCOP Domain Sequences for d1w9ob2:

Sequence; same for both SEQRES and ATOM records:

>d1w9ob2 b.36.1.1 (B:197-272) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitimpa

Timeline for d1w9ob2:

• d1w9ob2 is new in SCOP 1.73
  
• d1w9ob2 appears in SCOP 1.75
  
• d1w9ob2 appears in the current release, SCOPe 2.08