![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.26: Prismane protein-like [56820] (1 superfamily) 3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology |
![]() | Superfamily e.26.1: Prismane protein-like [56821] (4 families) ![]() |
![]() | Family e.26.1.1: Hybrid cluster protein (prismane protein) [56822] (2 proteins) contains extra N-terminal 3-helical bundle domain automatically mapped to Pfam PF03063 |
![]() | Protein automated matches [190096] (1 species) not a true protein |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [186817] (1 PDB entry) |
![]() | Domain d1w9ma_: 1w9m A: [120786] automated match to d1e1da_ complexed with fs2, sf4 |
PDB Entry: 1w9m (more details), 1.35 Å
SCOPe Domain Sequences for d1w9ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9ma_ e.26.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]} mfcfqcqetakntgctvkgmcgkpeetanlqdllifvlrgiaiygeklkelgqpdrsndd fvlqglfatitnanwddarfeamiseglarrdklrnaflavykakngkdfseplpeaatw tgdstafaekaksvgilatenedvrslrelliiglkgvaayaehaavlgfrkteidefml ealasttkdlsvdemvalvmkaggmavttmalldeantttygnpeitqvnigvgknpgil isghdlkdmaellkqtegtgvdvythgemlpanyypafkkyphfvgnyggswwqqnpefe sfngpillttnclvplkkentyldrlyttgvvgyegakhiadrpaggakdfsaliaqakk cpppveietgsivggfahhqvlaladkvveavksgaikrfvvmagcdgrqksrsyyteva enlpkdtviltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgldd indlpvsydiawyeqkavavllallflgvkgirlgptlpaflspnvakvlvenfnikpig tvqddiaammagk
Timeline for d1w9ma_: