Lineage for d1w9ha1 (1w9h A:93-408)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996500Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 996514Protein Hypothetical protein AF1318 [142503] (1 species)
  7. 996515Species Archaeoglobus fulgidus [TaxId:2234] [142504] (3 PDB entries)
    Uniprot O28951 11-427
  8. 996516Domain d1w9ha1: 1w9h A:93-408 [120785]
    complexed with cd, cl, ni

Details for d1w9ha1

PDB Entry: 1w9h (more details), 1.95 Å

PDB Description: the structure of a piwi protein from archaeoglobus fulgidus.
PDB Compounds: (A:) hypothetical protein af1318

SCOPe Domain Sequences for d1w9ha1:

Sequence, based on SEQRES records: (download)

>d1w9ha1 c.55.3.10 (A:93-408) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
fdsiksqvdnaidtgvdgimlvlpeyntplyyklksylinsipsqfmrydilsnrnltfy
vdnllvqfvsklggkpwilnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwne
ispivtsseyltylkstikkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketv
eelkkqemvsrdvkyailhlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpyl
krnglemvtpikplsveivsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvn
ypklvagiianvnryg

Sequence, based on observed residues (ATOM records): (download)

>d1w9ha1 c.55.3.10 (A:93-408) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
fdsiksqvdnaidtgvdgimlvlpeyntplyyklksylinsipsqfmrydiltfyvdnll
vqfvsklggkpwilnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwneispiv
tsseyltylkstikkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketveelkk
qemvsrdvkyailhlnethpfwvmhpyegtkvklsskrylltllqpylvtpikplsveiv
sdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryg

SCOPe Domain Coordinates for d1w9ha1:

Click to download the PDB-style file with coordinates for d1w9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1w9ha1: