Lineage for d1w9gb1 (1w9g B:1-103)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741921Fold d.330: ERH-like [143874] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10
  4. 741922Superfamily d.330.1: ERH-like [143875] (1 family) (S)
  5. 741923Family d.330.1.1: ERH-like [143876] (1 protein)
    Pfam PF01133
  6. 741924Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)
  7. 741925Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries)
    also includes 100% identical human protein P84090 (1W9G)
  8. 741928Domain d1w9gb1: 1w9g B:1-103 [120784]
    automatically matched to 1WWQ A:8-111

Details for d1w9gb1

PDB Entry: 1w9g (more details), 2 Å

PDB Description: structure of erh (enhencer of rudimentary gene)
PDB Compounds: (B:) Enhancer of rudimentary homolog

SCOP Domain Sequences for d1w9gb1:

Sequence, based on SEQRES records: (download)

>d1w9gb1 d.330.1.1 (B:1-103) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag

Sequence, based on observed residues (ATOM records): (download)

>d1w9gb1 d.330.1.1 (B:1-103) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnstydisqlfdfidd
ladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag

SCOP Domain Coordinates for d1w9gb1:

Click to download the PDB-style file with coordinates for d1w9gb1.
(The format of our PDB-style files is described here.)

Timeline for d1w9gb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w9ga1