Lineage for d1w9bm_ (1w9b M:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083019Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 2083049Species White mustard (Sinapis alba) [TaxId:3728] [51523] (18 PDB entries)
  8. 2083061Domain d1w9bm_: 1w9b M: [120777]
    automated match to d1dwam_
    complexed with cgt, gol, nag, so4, zn

Details for d1w9bm_

PDB Entry: 1w9b (more details), 1.7 Å

PDB Description: s. alba myrosinase in complex with carba-glucotropaeolin
PDB Compounds: (M:) glycosidase

SCOPe Domain Sequences for d1w9bm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9bm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]}
eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
vtdrdlkksgqwyqsfisp

SCOPe Domain Coordinates for d1w9bm_:

Click to download the PDB-style file with coordinates for d1w9bm_.
(The format of our PDB-style files is described here.)

Timeline for d1w9bm_: