SCOPe 2.07: Domain d1w94b1: 1w94 B:1-154

Lineage for d1w94b1 (1w94 B:1-154)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.2: Brix domain [142420] (1 protein)
   Pfam PF04427; tandem repeat of two ABD-like structural repeats, which are associated together with the formation of single beta-sheet, folded into half-barrel

6. Protein Probable ribosomal biogenesis protein [142421] (2 species)
   comprises stand-alone brix domain

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [142422] (1 PDB entry)
   Uniprot O26776 1-154
   MTH680

8. Domain d1w94b1: 1w94 B:1-154 [120775]
   automatically matched to 1W94 A:1-154

Details for d1w94b1

PDB Entry: 1w94, 2 Å

PDB Description: crystal structure of mil (mth680), an archaeal imp4-like protein

PDB Compounds: (B:) Probable brix-domain ribosomal biogenesis protein

SCOPe Domain Sequences for d1w94b1:

Sequence, based on SEQRES records:

>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari
tflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrdaw
sirtdeeyawvmelmdargtpagfkllirdfrvg

Sequence, based on observed residues (ATOM records):

>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari
tflderggergyilfnpsfemkkpekavrvsscppgseglcnlmglevdesrdawsirtd
eeyawvmelmdargtpagfkllirdfrvg

Timeline for d1w94b1:

• d1w94b1 first appeared in SCOP 1.73
  
• d1w94b1 appears in SCOPe 2.06