![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
![]() | Family c.51.1.2: Brix domain [142420] (1 protein) Pfam PF04427; tandem repeat of two ABD-like structural repeats, which are associated together with the formation of single beta-sheet, folded into half-barrel |
![]() | Protein Probable ribosomal biogenesis protein [142421] (2 species) comprises stand-alone brix domain |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [142422] (1 PDB entry) Uniprot O26776 1-154 MTH680 |
![]() | Domain d1w94b1: 1w94 B:1-154 [120775] automatically matched to 1W94 A:1-154 |
PDB Entry: 1w94 (more details), 2 Å
SCOPe Domain Sequences for d1w94b1:
Sequence, based on SEQRES records: (download)
>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]} mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari tflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrdaw sirtdeeyawvmelmdargtpagfkllirdfrvg
>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]} mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari tflderggergyilfnpsfemkkpekavrvsscppgseglcnlmglevdesrdawsirtd eeyawvmelmdargtpagfkllirdfrvg
Timeline for d1w94b1: