Lineage for d1w94b1 (1w94 B:1-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881983Family c.51.1.2: Brix domain [142420] (1 protein)
    Pfam PF04427; tandem repeat of two ABD-like structural repeats, which are associated together with the formation of single beta-sheet, folded into half-barrel
  6. 2881984Protein Probable ribosomal biogenesis protein [142421] (2 species)
    comprises stand-alone brix domain
  7. 2881987Species Methanobacterium thermoautotrophicum [TaxId:145262] [142422] (1 PDB entry)
    Uniprot O26776 1-154
    MTH680
  8. 2881989Domain d1w94b1: 1w94 B:1-154 [120775]
    automatically matched to 1W94 A:1-154

Details for d1w94b1

PDB Entry: 1w94 (more details), 2 Å

PDB Description: crystal structure of mil (mth680), an archaeal imp4-like protein
PDB Compounds: (B:) Probable brix-domain ribosomal biogenesis protein

SCOPe Domain Sequences for d1w94b1:

Sequence, based on SEQRES records: (download)

>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari
tflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrdaw
sirtdeeyawvmelmdargtpagfkllirdfrvg

Sequence, based on observed residues (ATOM records): (download)

>d1w94b1 c.51.1.2 (B:1-154) Probable ribosomal biogenesis protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari
tflderggergyilfnpsfemkkpekavrvsscppgseglcnlmglevdesrdawsirtd
eeyawvmelmdargtpagfkllirdfrvg

SCOPe Domain Coordinates for d1w94b1:

Click to download the PDB-style file with coordinates for d1w94b1.
(The format of our PDB-style files is described here.)

Timeline for d1w94b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w94a1