SCOP 1.75: Domain d1w91f1: 1w91 F:4-13,F:361-502

Lineage for d1w91f1 (1w91 F:4-13,F:361-502)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Beta-D-xylosidase [101926] (2 species)
   glycosyl hydrolase family 39

7. Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries)
   Uniprot Q9ZFM2 5-14,362-503

8. Domain d1w91f1: 1w91 F:4-13,F:361-502 [120768]
   Other proteins in same PDB: d1w91a2, d1w91b2, d1w91c2, d1w91d2, d1w91e2, d1w91f2, d1w91g2, d1w91h2
   automatically matched to 1W91 A:4-13,A:361-502

Details for d1w91f1

PDB Entry: 1w91, 2.2 Å

PDB Description: crystal structure of 1,4-beta-d-xylan xylohydrolase solve using anomalous signal from seleniomethionine

PDB Compounds: (F:) beta-xylosidase

SCOP Domain Sequences for d1w91f1:

Sequence; same for both SEQRES and ATOM records:

>d1w91f1 b.71.1.2 (F:4-13,F:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]}
vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsav
fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv
lsknevtlieieqvrdetstyvglddgeitsys

Timeline for d1w91f1:

• d1w91f1 first appeared in SCOP 1.73
  
• d1w91f1 appears in SCOPe 2.01
  
• d1w91f1 appears in the current release, SCOPe 2.08